DISCLAIMER: This product is strictly for research use only. It is meant solely for laboratory testing and in vitro studies-not for use in or on humans or animals. All details provided on this site are for educational purposes. This item is not intended to be used as a drug, supplement, or cosmetic, and must not be misrepresented as such.
GLP-1 S
GLP-1 S is a medication originally developed to help regulate blood sugar in people with type 2 diabetes. It mimics a natural hormone in the body (GLP-1) that helps control appetite, insulin levels, and digestion. Recently, it has gained significant attention in research for its effects on weight loss and metabolic health.
Variant: 5 mg
Quantity: 1
All peptides arrive in powdered form for stability.
Third-Party Verified Purity
Each batch is tested and certified to meet or exceed 99% purity standards.
Made in the USA
Produced in United States WHO/GMP and ISO 9001:2015 certified facilities.
Rigorous Quality Control
Double-tested to ensure the highest quality for the most effective research.
What is GLP-1 S?
GLP-1 S is a GLP-1 receptor agonist originally developed to treat type 2 diabetes. It works by mimicking the body's natural GLP-1 hormone to regulate blood sugar, curb appetite, and slow digestion. In recent clinical trials, it has also shown powerful effects on long-term weight loss, leading to its FDA approval under the brand name Wegovy for chronic weight management.
Potential Benefits Shown in Studies
- Supporting long-term weight loss
- Reducing appetite and food cravings
- Controlling blood sugar levels
- Slowing digestion to help with fullness
- Supporting cardiovascular health
- Improving insulin sensitivity
- Lowering inflammation in metabolic tissues
Mechanisms of Action
GLP-1 S exerts its effects by:
- Activating GLP-1 receptors in the pancreas and brain
- Stimulating insulin secretion in response to elevated blood glucose
- Suppressing glucagon release, lowering hepatic glucose output
- Slowing gastric emptying, which promotes a feeling of fullness
- Reducing appetite through action on brain regions that regulate hunger
Molecular Structure of GLP-1 S

Sequence
HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG — with a modification at position 26 (Lys26 acylated with a C-18 fatty diacid chain for longer activity)
Molecular Properties
GLP-1 S Research Highlights
In the STEP 1 trial, patients with obesity receiving Semaglutide 2.4 mg weekly lost an average of 14.9% of their body weight in 68 weeks — significantly outperforming the placebo group.
Semaglutide improves HbA1c levels, increases insulin sensitivity, and reduces the risk of cardiovascular events in people with type 2 diabetes.
