FREE SHIPPING on Orders Over $200
🇺🇸 All Peptides Made in the USA

DISCLAIMER: This product is strictly for research use only. It is meant solely for laboratory testing and in vitro studies-not for use in or on humans or animals. All details provided on this site are for educational purposes. This item is not intended to be used as a drug, supplement, or cosmetic, and must not be misrepresented as such.

GLP-1 S

GLP-1 S

GLP-1 S is a medication originally developed to help regulate blood sugar in people with type 2 diabetes. It mimics a natural hormone in the body (GLP-1) that helps control appetite, insulin levels, and digestion. Recently, it has gained significant attention in research for its effects on weight loss and metabolic health.

$120/each
Variant: 5 mg
5 mg
10 mg
Quantity: 1
1
5 (5% OFF)
10 (10% OFF)
Custom

All peptides arrive in powdered form for stability.

Third-Party Verified Purity
Third-Party Verified Purity

Each batch is tested and certified to meet or exceed 99% purity standards.

Made in the USA
Made in the USA

Produced in United States WHO/GMP and ISO 9001:2015 certified facilities.

Rigorous Quality Control
Rigorous Quality Control

Double-tested to ensure the highest quality for the most effective research.

What is GLP-1 S?

GLP-1 S is a GLP-1 receptor agonist originally developed to treat type 2 diabetes. It works by mimicking the body's natural GLP-1 hormone to regulate blood sugar, curb appetite, and slow digestion. In recent clinical trials, it has also shown powerful effects on long-term weight loss, leading to its FDA approval under the brand name Wegovy for chronic weight management.

Potential Benefits Shown in Studies

  • Supporting long-term weight loss
  • Reducing appetite and food cravings
  • Controlling blood sugar levels
  • Slowing digestion to help with fullness
  • Supporting cardiovascular health
  • Improving insulin sensitivity
  • Lowering inflammation in metabolic tissues

Mechanisms of Action

GLP-1 S exerts its effects by:

  • Activating GLP-1 receptors in the pancreas and brain
  • Stimulating insulin secretion in response to elevated blood glucose
  • Suppressing glucagon release, lowering hepatic glucose output
  • Slowing gastric emptying, which promotes a feeling of fullness
  • Reducing appetite through action on brain regions that regulate hunger

Molecular Structure of GLP-1 S

GLP-1 S molecular structure

Sequence

HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG — with a modification at position 26 (Lys26 acylated with a C-18 fatty diacid chain for longer activity)

Molecular Properties

Formula

C₁₈₇H₂₉₁N₄₅O₅₉

Weight

4113.58 g/mol

Source
PubChem

Certificate of Analysis

Lot: 251127SMG1001 - 10mg

View COA

Lot: 2509260052 - 10mg
View COA

GLP-1 S Research Highlights

In the STEP 1 trial, patients with obesity receiving Semaglutide 2.4 mg weekly lost an average of 14.9% of their body weight in 68 weeks — significantly outperforming the placebo group.

Semaglutide improves HbA1c levels, increases insulin sensitivity, and reduces the risk of cardiovascular events in people with type 2 diabetes.

Disclaimer: GLP-1 S is a prescription medication approved for the treatment of type 2 diabetes and weight management. This content is provided for educational purposes only and does not constitute medical advice.

Peptide Research You Might Also Like

Copyright © 2026 Peptide Restore|Terms and Conditions|Privacy Policy